SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288843|ref|YP_008875065.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288843|ref|YP_008875065.1|
Domain Number 1 Region: 25-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000125
Family Cgl2762-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564288843|ref|YP_008875065.1|
Sequence length 181
Comment transposase [Haloarcula hispanica N601]
Sequence
MAALDDATLDDLREALAEVEDKKPTQRLMAVINYLEEDSATMAEVAERYGYTGPWLSRWV
GRLDRLADEPVEQVVYDDPREGRTAELSGEQYDQFVEALHESPEEVGLDAPAWSVPLARH
YLAEEFDVEYCERHVRRLMSEAGLSWKTARPEYYKSDERAQEAWQEGFKKSATTWTTNTR
S
Download sequence
Identical sequences G0HUC1 V5TKF1
gi|344209738|ref|YP_004785915.1| gi|344210840|ref|YP_004795160.1| gi|564288843|ref|YP_008875065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]