SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288910|ref|YP_008875133.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288910|ref|YP_008875133.1|
Domain Number 1 Region: 107-202
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.88e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0041
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily Homeodomain-like 1.7e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564288910|ref|YP_008875133.1|
Sequence length 210
Comment transcriptional regulator [Haloarcula hispanica N601]
Sequence
MTDGIPFAGEPADSHEAIMRATFRALREYGYAGLSIQRIADEADLSKSTFYHHFDGKEDL
LLSFQEFILTEFNRIFQVESTGDPEQDIKTFVSLVLDDFPDCVETPDKNAVLGSYVEMRA
QAVQNPDFREKFTETDELFARQLVQIIEDGIEQGVFADVNPETVSRFMITILDGVILQSA
TRNDNPVAEVRDTIDEYIEETLILGTYSSH
Download sequence
Identical sequences A0A0B5GVF6 A0A165M415 G0HUT2 V5TIB1
gi|564288910|ref|YP_008875133.1| gi|344210907|ref|YP_004795227.1| WP_014039578.1.13069 WP_014039578.1.27393 WP_014039578.1.67629 WP_014039578.1.92404 WP_014039578.1.92869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]