SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564289918|ref|YP_008876193.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564289918|ref|YP_008876193.1|
Domain Number 1 Region: 310-406,475-491,642-705
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 7.38e-28
Family Intein (protein splicing domain) 0.024
Further Details:      
 
Domain Number 2 Region: 561-659
Classification Level Classification E-value
Superfamily Homing endonucleases 3.91e-16
Family Intein endonuclease 0.012
Further Details:      
 
Weak hits

Sequence:  gi|564289918|ref|YP_008876193.1|
Domain Number - Region: 479-547
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000159
Family Group I mobile intron endonuclease 0.069
Further Details:      
 
Domain Number - Region: 417-457
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0825
Family GalR/LacI-like bacterial regulator 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564289918|ref|YP_008876193.1|
Sequence length 1075
Comment SpoVR family protein [Haloarcula hispanica N601]
Sequence
MNDDRFAKQRVADDLDEPVEEAGNLARKLGLKPYPVNYWIVDYDEMNELIAYGGFQQRYP
HWRWGMQYDRQQKQGQFLGGKAFEIVNNDDPAHAFLQESNTLADQKAVITHVEAHADFFA
NNEWFRMFTDGSSRTTTDASGEDRRRGPDAAGMLARHGDTIQEYMQDPDIERAEVERFID
HVLCLEDNIDQHIPYSPVETVPEEFEDIEGADVTEQLDDLELSEEVKRQVFDEEWLDAQR
DDDENVTFPAEPEKDVLGFLRKHGMQYDEDAERATEMEDWQTELLELLRREAYYFAPQKM
TKVMNEGWACVDPETPVFTADGLVPMEDVVSDHVTVSDGEQAREVYDSNIIPDHDTVTIE
TRRGFELTGSNNHRVRQPDGDWVRLDELETGDEIAVTGGNGTWPETNVPIEWTCSEYTSL
NDVADEAGVSVWTVMRYRRTGSAEKAEAIDRALDGYEEGGNAGLSNRESIRIPETVDELF
GRFLGLLIGDGHVPSNSRHIGFTSGKQAHAEEFAGLLSELFGIEATVERQESRWRVYAYS
KNLRDLLTEEFDLPTGVAAAEKTVPDQILRSPKQVVAEFIRGLFDADGYAGEQGAILSTK
SEDLSKRVQLLLTNFGVLSRRREQSDGCYHVHLTGASANTFADEIGFGYEAKATELSTYL
DELAWFETESWTDEIVDVETGTGDVYDISVEETHRYAAAGFVNHNSYWESTMMTGEQFAG
DDEFILYSDHMSKVLGSGGLNPYSLGLEIWEYVENTENRREVIERLLRVEGITWRNFDES
VDYKMVQDHLEPPAWLTAVPNHLDDLDPEDPRVDSDGLAAARDGEFDVEQYPWKVLTYEG
LAQRHYSLVKPQYRGFVSRVGQEELERTARYMFDDSRYDSVEDALGDVDYSRGWERMREI
RESHNDVTFLDEFLTQEFVDDNDYFTYEYTHASGDYRVTSTDHEDVKKKLMLQFTNFGKP
TVVVEDGNYQNRNELLLAHQYNGVMLDIGQAKEVLKRTFELWGRPVNLLTIVKEFDDHDV
EVAKRRDREPEPEEVGKRIRYDGDEVTVTDVDWSEVEHLTATDIDYNTKPDEWLA
Download sequence
Identical sequences G0HT69 V5TNB8
WP_014040497.1.67629 WP_014040497.1.92404 gi|344211953|ref|YP_004796273.1| gi|564289918|ref|YP_008876193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]