SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564290258|ref|YP_008876549.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564290258|ref|YP_008876549.1|
Domain Number 1 Region: 85-203
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.26e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000482
Family Tetracyclin repressor-like, N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564290258|ref|YP_008876549.1|
Sequence length 204
Comment AcrR family transcriptional regulator [Haloarcula hispanica N601]
Sequence
MSESDGQTTPQDTREVIMEATFRALSKHGYKDLRVRDIGEEMDMSRQVIHYHFDGKYDLI
SSFLEYIIDQYEGSVEVDDETDPRAELDVRIDRCLFGPEFDDFSHWDRMKVYHELYAYAQ
NDDEHRALFNEHYDRLRESIATVIEDGIEQGAFRDVDAELMGQLITDVIHAARGRRIALG
HEDAPDEAKRAINDFILDSLYPPQ
Download sequence
Identical sequences G0HVL7 V5TP94
WP_014040795.1.67629 WP_014040795.1.92404 gi|564290258|ref|YP_008876549.1| gi|344212307|ref|YP_004796627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]