SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564290985|ref|YP_008877308.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|564290985|ref|YP_008877308.1|
Domain Number - Region: 1-86
Classification Level Classification E-value
Superfamily GlnB-like 0.0741
Family Prokaryotic signal transducing protein 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564290985|ref|YP_008877308.1|
Sequence length 426
Comment hypothetical protein HISP_14305 [Haloarcula hispanica N601]
Sequence
MRLVQILIPTGKRDAVLGVLAEEGIDYVLTDETSGREFTAVVTFPVPTNALEPVLEELRN
VGINDDGYTVVVDANTVISSQFDELEEKYAEEEDEDRIAREELTSKANDLAPSMSNYALM
TIISAIIATAGLLLDSPAVVVGSMVIAPLIGPAMTANVGTVVDDHEMFIQGVKLQAVGLG
LAVASATVFALLVRYANVIPPLADVTTVGQIRERVAPDFLSLIVALGAGAAGVVSLTSGV
STALVGVMIAVALIPPAATVGIGIAWGQPLVSLGSAVLLLVNVLSINLAVLVGLWYQGYR
PEHWFQESNARSATVKRIGVLVLSILVLSAFLGGVTFDSYQQATTESDIRDAIQGSVDSP
ARVLTVEIEYTNTAIFQQPRRVIVTVGLPPDAEQPLLVDQLDALADDAAGRDVATEVRYV
TVERNG
Download sequence
Identical sequences A0A0B5GI65 A0A166FZT2 G0HS58 V5TP88
gi|564290985|ref|YP_008877308.1| WP_014041456.1.13069 WP_014041456.1.27393 WP_014041456.1.67629 WP_014041456.1.92404 WP_014041456.1.92869 gi|344213063|ref|YP_004797383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]