SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564291193|ref|YP_008877530.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564291193|ref|YP_008877530.1|
Domain Number 1 Region: 11-121
Classification Level Classification E-value
Superfamily GlnB-like 4.85e-37
Family Prokaryotic signal transducing protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564291193|ref|YP_008877530.1|
Sequence length 121
Comment nitrogen regulatory protein P-II [Haloarcula hispanica N601]
Sequence
MTDETDDSEIKMVVAMVRPDKLGDVKKALAEVGAPSLTVTNVSGRGSQPAKKGQWRGEEY
VVDLHQKVKVETVVADIPAEDVVDAIADGAHTGEKGDGKIFVLPVDNAYQVRTGKEGPEA
V
Download sequence
Identical sequences A0A0B5GTW0 A0A165LH52 A0A1H2SK98 A0A2H5A216 G0HU54 M0J7S6 M0K4M2 M0K637 Q5UZ97 V5TRX4
gi|344213280|ref|YP_004797600.1| WP_004517663.1.13069 WP_004517663.1.27393 WP_004517663.1.28678 WP_004517663.1.67629 WP_004517663.1.69175 WP_004517663.1.78115 WP_004517663.1.84793 WP_004517663.1.89716 WP_004517663.1.91835 WP_004517663.1.92404 WP_004517663.1.92869 272569.rrnAC2621 gi|564291193|ref|YP_008877530.1| gi|55379262|ref|YP_137112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]