SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564287699|ref|YP_008873947.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564287699|ref|YP_008873947.1|
Domain Number 1 Region: 12-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-40
Family Extended AAA-ATPase domain 0.0024
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.93e-17
Family Helicase DNA-binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564287699|ref|YP_008873947.1|
Sequence length 395
Comment cell division control protein Cdc6 [Haloarcula hispanica N601]
Sequence
MSDITFSPTSTIFEQREALLEEWTPEELVGRDEELQKYHAALQPVINNETPSNIFLYGKS
GVGKTAATRYLLSALERDAADVDGLDLSTVEVNCDGLNSSYQAAVAIVNTLRDPANQISN
TGYPQASVYQFLFDALDDLGGTVLIVLDEVDHIEDDSLLYKLPRARSNGDISEAKLGVIG
ISNDLDFRNQLSSKVRSSLCEKEVSFSAYNANELQLVLKQREAVAFRDDVLDDGVIEMCA
AYGAKDSGDARQALDLLLEAGDLAREYDDELVTEHHVREARQRLQTDQVVEGIRNYSDHG
QLVLYALTGLAEDDDTPARTRDILGAYQELARDEGLDPVSERSVRDYLGELTQLGIVSSA
EYNRGKGGGKYKEFELEQSISSIKTGLSELLKKSP
Download sequence
Identical sequences G0HZ03 V5TT25
gi|564287699|ref|YP_008873947.1| gi|344209861|ref|YP_004786038.1| WP_014030919.1.67629 WP_014030919.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]