SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288459|ref|YP_008874662.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288459|ref|YP_008874662.1|
Domain Number 1 Region: 16-282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.95e-42
Family Extended AAA-ATPase domain 0.00035
Further Details:      
 
Domain Number 2 Region: 291-375
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-19
Family Penicillinase repressor 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564288459|ref|YP_008874662.1|
Sequence length 375
Comment ATPase AAA [Haloarcula hispanica N601]
Sequence
MSDDPEDRMLGWDESVFRDEHVFEIDWLPETFKHRDTQMETLKYALRPAVRGSRPLNVIA
RGPPGTGKTTAVQILFDELTAQTDVKTVRVNCQMDSTRYAVFSRLFAEIFDYEPPSSGIS
FKKLFSQITDKLVEEDEVLVVALDDVNYLFYESEASDTLYSLLRAHEAHSGAKIGVICVS
SDLELDVIDALDTRVQSVFRPEEVYFNPYGQAEIADILGERADRGFNEGVVGPTVLDRVA
ELTEEQGGDLRVGIDLLRRAGMNAEMRASRSVETEDVEEAYDKSKYVHLSRRLRELSDSE
TALVEVIAAHDGQQAGDIYDAFSEQTDLGYTRYSEIINKLDQLDIIDADYTNVEGRGRSR
ELTLNYDADAVLERL
Download sequence
Identical sequences A0A0B5GIZ6 A0A162FYQ0 G0HQY0 M0KWW8 V5TIV5
gi|344210439|ref|YP_004794759.1| gi|564288459|ref|YP_008874662.1| WP_008307001.1.13069 WP_008307001.1.27393 WP_008307001.1.67629 WP_008307001.1.92404 WP_008307001.1.92869 WP_008307001.1.94779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]