SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564290079|ref|YP_008876365.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564290079|ref|YP_008876365.1|
Domain Number 1 Region: 26-291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.68e-40
Family Extended AAA-ATPase domain 0.0011
Further Details:      
 
Domain Number 2 Region: 305-403
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000018
Family Helicase DNA-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564290079|ref|YP_008876365.1|
Sequence length 442
Comment cell division control protein Cdc6 [Haloarcula hispanica N601]
Sequence
MVDVNENPFDGTDAIFERKQPLKKDTFTPDTIFHRDEEIEFYINALQDVIVGHDPNNVFV
YGPTGVGKTAVTKWVRDKLEEKAEAEDIPLTVVGPINCRNYRSAYALVNTLVNEFRDPEN
QLPESGYSTDSVFEFLYEEIEAVGGNVLIILDEIDNIPADARNDFLYELPRAEANENTPI
TDAKVGLIGISNDLKFVDVLEPKVKSTLGEREIKFGPYDATELRDILGYYADIAFREDVL
GEDVVPLAAAFSAQERGDVRQGLRILEKAGEYARMEGADGVTEAHTRRATDTIETDELLD
YFEHDLSSQQALTYLATTLALIEPKHEASTKRIYNLYSSIAESSGRRVKSERKIYEFLDQ
LSMQGLVRSAERNLGRKGGRKYIYEVTDDATDIINAALQSSYSDAVPSNVNGILEHYLED
EATEFEAPDTTDDEQQNLWQFT
Download sequence
Identical sequences A0A0B5GG75 A0A165N6J8 G0HUK9 M0K2N3 V5TNI5
gi|344212124|ref|YP_004796444.1| gi|564290079|ref|YP_008876365.1| WP_008313351.1.13069 WP_008313351.1.27393 WP_008313351.1.67629 WP_008313351.1.92404 WP_008313351.1.92869 WP_008313351.1.94779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]