SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296241829|ref|YP_003649316.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296241829|ref|YP_003649316.1|
Domain Number 1 Region: 85-194
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 1.29e-16
Family V-type ATPase subunit E 0.0023
Further Details:      
 
Weak hits

Sequence:  gi|296241829|ref|YP_003649316.1|
Domain Number - Region: 13-71
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00288
Family F1F0 ATP synthase subunit B, membrane domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296241829|ref|YP_003649316.1|
Sequence length 194
Comment H+transporting two-sector ATPase E subunit [Thermosphaera aggregans DSM 11486]
Sequence
MDVNRHLTEARERILEEARRKAKMIVEEAEREAEIIVKKAEEEWKKRAMEEENRILEEAR
REAALKISEARRLSRLRISQEMASIIDELFKQAENGLNHLDLLEVEKSLENLLTDSLKYV
DKPRKVYVSEKDVETMRRILSRLGLGHVEVAPAEIRGGLILESESGILVDNSYESRLKLA
RRALTPLIRKKLWG
Download sequence
Identical sequences D5TZR4
gi|296241829|ref|YP_003649316.1| WP_013128957.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]