SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242047|ref|YP_003649534.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242047|ref|YP_003649534.1|
Domain Number 1 Region: 189-284
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000235
Family Multidrug resistance efflux transporter EmrE 0.025
Further Details:      
 
Weak hits

Sequence:  gi|296242047|ref|YP_003649534.1|
Domain Number - Region: 46-145
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00209
Family Multidrug resistance efflux transporter EmrE 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296242047|ref|YP_003649534.1|
Sequence length 294
Comment hypothetical protein Tagg_0306 [Thermosphaera aggregans DSM 11486]
Sequence
MADSSKRGKIKGIFFLVLTTILWGTSFSFIKLSVEEVSGFSYTFYRGLISILILTILLAA
KHARQGIDAKSFIKGLYTGVAYTTGLLLQGLGTQYVTPSTSAFITGLNTVHVHLYAGFLA
RKYGLTHAVSLVLAISGLYILTSPQNSGGLGEILVFMGSISWAAQIILVSKYSGSSMLEY
LYGMFTPTLFLAPYVFIVENGGELSLNAIVYIAYLAVACSLGATYFQVKGQKYVTASSAA
IIFLLEPVFALIFSLVMGLEDLVLYKLVGGGLIVLAIYITTIGELKEYNKSRHA
Download sequence
Identical sequences D5U0D2
WP_013129175.1.1770 gi|296242047|ref|YP_003649534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]