SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242073|ref|YP_003649560.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242073|ref|YP_003649560.1|
Domain Number 1 Region: 7-120,224-420
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 6.41e-97
Family Substrate-binding domain of HMG-CoA reductase 0.00000016
Further Details:      
 
Domain Number 2 Region: 113-219
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.12e-29
Family NAD-binding domain of HMG-CoA reductase 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296242073|ref|YP_003649560.1|
Sequence length 426
Comment hydroxymethylglutaryl-CoA reductase [Thermosphaera aggregans DSM 11486]
Sequence
MAERTSRIQGFYKLPMGERLRTIAEMTGLSEDEVKTLSNLGNLPPEIADSMIENVIGGMT
YPFAIATNFKINGLDYLVPMVIEETSVVAAASNAARMLRYGEGIRAEAGPQEMISQIHLV
NVTAPQYKAMKIIEAKQEILEHAKQQDPTLLKYGGGPRDLEVRVIDSRMGPVIIVHLIVD
VRDAMGANTVNTMAEAIAPMLEKVTGGQARLKIVSNYATRRIVRAWARTPADEVGGLDVA
KKIVEASILAEIDPYRAVTHNKGIMNGIIAVALATAQDHRAIEAGAHAYASRTGHYRPLS
YWEVDEHGFLVGSIELPLQVGIVGGATRVHPVAKIALKILNVKTAKELSEVMAAVGLAQN
LAALRALVTEGIQKGHMRLHARNLAIMAGATGDLIDRIAEKMISDGRIRYDYAKELLEKY
LRGEPT
Download sequence
Identical sequences D5U0F8
WP_013129201.1.1770 gi|296242073|ref|YP_003649560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]