SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242185|ref|YP_003649672.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242185|ref|YP_003649672.1|
Domain Number 1 Region: 225-298,325-680
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-91
Family Amylase, catalytic domain 0.000000179
Further Details:      
 
Domain Number 2 Region: 85-136
Classification Level Classification E-value
Superfamily E set domains 0.0000000000084
Family AMPK-beta glycogen binding domain-like 0.038
Further Details:      
 
Weak hits

Sequence:  gi|296242185|ref|YP_003649672.1|
Domain Number - Region: 686-746
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0122
Family alpha-Amylases, C-terminal beta-sheet domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296242185|ref|YP_003649672.1|
Sequence length 763
Comment alpha amylase [Thermosphaera aggregans DSM 11486]
Sequence
MKRRELIIVAGLLLTVALILTLSSTLSRDQGVNTTPLFTTTTETVTQAPLKHFEDVYVSL
MIEQLKCQPPKAPVYFRFTPFPNETIYRVSVAGDFTGWAPHDMFMLDNGTWTALFCVPPG
TVVYKYLINGAWVRDMSTDHYGLPVDPDAQGYVDDGFGGKNALRQVSFPSETRFFIHIED
DPVYLSLADEMLVARLFTSNIRDASVYLVVNGEYYRMKKQLWTDYTIVWYREIPLYETIQ
YYFIIDFGTHGLRIFKDPVNKYFNSNATRFFKQVSWVREAIGYQIFPDRFYNGDPSNDLR
GNETDELWLNELAGGVKPIFSSWSDPITSLHCCHQYFGGDLAGVLAKLDYLESLGVKMIY
FNPIFLSGSAHGYDTYDYFLIDPKYGNETILRTLLDEAHRRGMKVIFDFVPNHVGIGFWA
FRDVYRNGPRSPYWNWFIIKKWPFKLGDGTAYECWWGIGSLPKLNHSNLEVKQYLFNVAL
HWLEFGFDGLRIDAPLEVLDADNFYRELRTLVKERYPDAYIVAEIWSLSPEWLKGRHFDS
LMNYALGRDILLQYAAGKKNGDQVFRDLYNYYAQVPVGVAGMGFNIIGSHDTSRILTDLG
GGRIGSTPTNESIRRLKLLITLQFTVPGMPVIFQGDERGILGSSSYYDEQRYPIQWDRII
PEVYEAYSRMSWIKRNIPALKTSIISLYASNGSVISFFRGYDNEVLVIANNDLDSKIFTL
PAGKWVVVSYGETRIVEGDLVIEGLAGIVLVRYDYAISLGLIG
Download sequence
Identical sequences D5U0S0
gi|296242185|ref|YP_003649672.1| WP_013129313.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]