SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242194|ref|YP_003649681.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242194|ref|YP_003649681.1|
Domain Number 1 Region: 44-127
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000942
Family Multidrug resistance efflux transporter EmrE 0.019
Further Details:      
 
Domain Number 2 Region: 204-281
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000235
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296242194|ref|YP_003649681.1|
Sequence length 282
Comment hypothetical protein Tagg_0454 [Thermosphaera aggregans DSM 11486]
Sequence
MRISRVKDLKDLPGFLLIWVSISSASIIVVLSNAPAEVCAFWRTFLTSLIFAPVTLVRRT
FIFKPHHVLSGVFLGLHFVFWMQSLFLLPVYQSTLIVVTYPVFNVVLDFLFFNEKPGLKK
VLGFSATLTLLWIFLQVNNLTYNHGVILAFSASLFAAGYFEIGRYARTKLGESTLTYATP
TYLTASAIALTYSVLKGSEIFSYPFETYAAFILLAVIPMIGGHTLMNYYMKKYPASTVAS
IALGEPFGAGLLGMIFLSQPLTLLSLFIGFLIISAIILIIYQ
Download sequence
Identical sequences D5U0S9
WP_013129322.1.1770 gi|296242194|ref|YP_003649681.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]