SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242591|ref|YP_003650078.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242591|ref|YP_003650078.1|
Domain Number 1 Region: 90-189
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.53e-25
Family Ribosomal protein S3 C-terminal domain 0.00095
Further Details:      
 
Domain Number 2 Region: 10-98
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.37e-22
Family Prokaryotic type KH domain (KH-domain type II) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296242591|ref|YP_003650078.1|
Sequence length 229
Comment 30S ribosomal protein S3 [Thermosphaera aggregans DSM 11486]
Sequence
MVGPRVKSYFLSYGLKKLMIDEFLANYFKDAGYAGVEVFRTPTGHRVVIYAEYPGRLIGR
GGSVIKKLTTILQTRFGLENVNITVSPVMDPDLNARVVAFRIVRALEKEIPFRRVMMGML
KRIMDAGAVGAEIIISGKLRGERATYEKMRVGKIYKAGEPVEYIIDRAVARALLKPGIYG
VEVLIVKPGIKLPDHVEIKPVKPEALKQEAQQAGGEEKALQEGGGVEGQ
Download sequence
Identical sequences D5U1X6
gi|296242591|ref|YP_003650078.1| WP_013129719.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]