SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242634|ref|YP_003650121.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242634|ref|YP_003650121.1|
Domain Number 1 Region: 215-622
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.61e-89
Family Amylase, catalytic domain 0.000000561
Further Details:      
 
Domain Number 2 Region: 24-88
Classification Level Classification E-value
Superfamily E set domains 0.00000000336
Family AMPK-beta glycogen binding domain-like 0.017
Further Details:      
 
Weak hits

Sequence:  gi|296242634|ref|YP_003650121.1|
Domain Number - Region: 119-228
Classification Level Classification E-value
Superfamily E set domains 0.0224
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296242634|ref|YP_003650121.1|
Sequence length 691
Comment alpha amylase [Thermosphaera aggregans DSM 11486]
Sequence
MIRLLGRRIINGGRARGFLVEFSREWPENAKRIYLVGNFTSWFPGFKRLAKKGGRGFTVL
ELFPGLYGYGFVVDNDFTILLDPENPDTILLPNVMTLEEKAFRGSRLELKPPTDPREYVV
HDENDEAFLHRHLDYYVLRLRTNTKVSKSVLIANNEEYGASVVYETGFEKIFEHHIPAEK
VGRALTYYFMVEVPGEAFSYGFNGVGERVQPFQVYAGDVKGFEKPSWYMGTVYYHVFVDS
FYNADRSNDPPGTVPDTVPRRHGYLGGDLKGVVVKLDHIVSLGAEAIYLTPIFPAGTYHR
YDVRNYLGVDPYLGSTRDFEELVRKAGERGVKIVLDITLHHMGVCHEFFRDALIKREDSK
YWDWFVFLEKPREDFVNEAAKLLEECDYQGLRTLVSKAGYRRPFYEAFYTVWAMPRINHE
NPETLKYFIHVAETWVGRGVGGFRIDVAHGVMDTWLQAFYRAVKKNSEDAVIIGEVCDYP
FLYKGCMDSYMNYWLRYILLGTLVKGFLSPREMVWKIGEILASHPVYQATMLYNLLGSHD
TPRIIEVVNKDKTLLKLLINLLNLLPGSLAIYYGDEIGLEGGHDPDNRRPMRWNQGEWDA
EVLNTYLEAIALRRKHPAVRYGFTRTWLCGDGVLVVERWLREDRVIGLFNLNEREADVSG
CFEKLFEEASHRDYAGLKPLPRYGFIIIESN
Download sequence
Identical sequences D5U219
gi|296242634|ref|YP_003650121.1| WP_013129762.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]