SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242668|ref|YP_003650155.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242668|ref|YP_003650155.1|
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 0.000000000000235
Family Ribosomal protein L39e 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296242668|ref|YP_003650155.1|
Sequence length 52
Comment 50S ribosomal protein L39E [Thermosphaera aggregans DSM 11486]
Sequence
MARFKHLARKLRLAAAEKTNKPIPIWVSVKTRMRVRRGFRLRNWRRSKLKNI
Download sequence
Identical sequences D5U253
gi|296242668|ref|YP_003650155.1| WP_013129796.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]