SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242695|ref|YP_003650182.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242695|ref|YP_003650182.1|
Domain Number 1 Region: 194-280
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000034
Family Apolipoprotein 0.013
Further Details:      
 
Weak hits

Sequence:  gi|296242695|ref|YP_003650182.1|
Domain Number - Region: 281-375
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0209
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296242695|ref|YP_003650182.1|
Sequence length 519
Comment hypothetical protein Tagg_0960 [Thermosphaera aggregans DSM 11486]
Sequence
MGSSVNVFPKKYMPFLLKHTAEAYQKLGDDEVVGFALYYSEKLRKKPGFFRRKGERIRAV
VLAYYPLLAKPFSKETAVLIDPLKNTRFTIQYNVVDKNLLDSAFRELSAMTGKSFLDGLV
KLSRLAQDAASARSGVRKEIVELNNVVSDPGLLQGLKPLIGMETNYNIPIIEIPFPSVDH
EEVARRISKAMREIDELIEYVNNVLEKVRDLLEAWKKEITKEYDEKLRIMDEKIEETKRA
VAKAIEELKRKRDEELSSVKERHLPNIESIEKRIVETRENVIRLEEELEKAKAYGKDTSD
LKKRLNDQKKTLKNLEKELENARASYDDDVKRIEKKYNELIEAENNKVKSILSERDAVRR
ELETLIQEAGKRFDAIRSGLQDYLEQLVNVEKKVEEISITAPSKSEELYLIPILYTSYAS
EKTTRSSITTIVVLEPGGRLGQRFTPYIHEGIANYFSWVKQMLDKKDMAPEITSKNLLTN
TTPERIEVCLTRLSEIGLLTRDDASEMARRLEEQMKMSS
Download sequence
Identical sequences D5U280
WP_013129823.1.1770 gi|296242695|ref|YP_003650182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]