SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242717|ref|YP_003650204.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242717|ref|YP_003650204.1|
Domain Number 1 Region: 35-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000183
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 185-282
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000379
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296242717|ref|YP_003650204.1|
Sequence length 284
Comment hypothetical protein Tagg_0982 [Thermosphaera aggregans DSM 11486]
Sequence
MDYIAPVIASLTWSINPAVISRYRDHIKPVLFTGFRALAALSFLIPFTIWVNPGLTGFTA
TSIIVVMLSAVLGPGIGDASYTRAIQILGGSLAVVVSYTYIFVSQVIAIVFLGEPLRFSV
IAGSLIAFAGIVIASVNGNGGRISLNGLAYAATASITWGIATSLIKVALLYADTLILTVM
RLGFIAIFFIPAGLIVEGGPGEADTRPLIKASLITGVLGWSIGMLLFIYSINRIGVSATA
VATALTPVLSQLTVKLLSREKPTLKTLAGALLISSGIVVSILFP
Download sequence
Identical sequences D5U2A2
gi|296242717|ref|YP_003650204.1| WP_013129845.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]