SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242797|ref|YP_003650284.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242797|ref|YP_003650284.1|
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily GlnB-like 1.22e-36
Family Divalent ion tolerance proteins CutA (CutA1) 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296242797|ref|YP_003650284.1|
Sequence length 106
Comment CutA1 divalent ion tolerance protein [Thermosphaera aggregans DSM 11486]
Sequence
MEGGWAVVLVTASSYEEALKIGRRLVEAKLAACLNIVREVTSIYWWEGRVEEGSEALLIV
KTTFEKLESLIKEVKKIHSYSVPEIIALPVVAGSTDYLRWVRESTS
Download sequence
Identical sequences D5U2I2
WP_013129925.1.1770 gi|296242797|ref|YP_003650284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]