SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242800|ref|YP_003650287.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242800|ref|YP_003650287.1|
Domain Number 1 Region: 250-603
Classification Level Classification E-value
Superfamily SIS domain 2.41e-79
Family double-SIS domain 0.00000805
Further Details:      
 
Domain Number 2 Region: 3-225
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.58e-50
Family Class II glutamine amidotransferases 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296242800|ref|YP_003650287.1|
Sequence length 604
Comment glutamine--fructose-6-phosphate transaminase [Thermosphaera aggregans DSM 11486]
Sequence
MGGIFAAVCKEKIPEGVLYNGLRRLVYRGYDGAGVAFLRGDKIVVWKSPGHLEKIAPQLN
YLNTDSDVAVAHTRYASRGWPVLENTHPLLDCTGRIAVVGDGIIENYEDYRKVLEDRHHQ
LKGRTDTEVAAHLLEEALAKGVNVLEVLQTLSKQLKGIYSLVFLIEPYRKLFFIANGQPL
VIGIGEKCYFVSSDIPSLYGFAETAYMIEDGTIGWVDAQGFTAIRTADGSVLTPERLQGK
RVKYFAEAGEKGGFPHFMLKEIYESPEALNRVLLAVMEKYLHLASMIVYGAKNAFILANG
TSLHAGMIGSYYFNDLAGVSVDPVSAAEFPYYALETVETGTVVIAISQSGETSDVISSIK
LAKQRGAVVIGITNNVGSRLALESNVYLPIGAGPEIAVPATKSFTATLATLLLFASYTGM
FTGKTSRDDYRRIVEEIKNASALLKEKIPEFDKNAMNIVQLNYNWGGAYVASSGINYPLA
LEGALKLKEAAIIHAEGFQLGEMRHGPMVLVSRDFPMVLIEPAEEQAKPLYVKVLEEARN
KGAKPIVIGPGRLGDSVTIQTPSVPRYLSPIVSSIPIQLLAYRLGVAFNRPIDTPPGLAK
AITT
Download sequence
Identical sequences D5U2I5
WP_013129928.1.1770 gi|296242800|ref|YP_003650287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]