SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296242807|ref|YP_003650294.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242807|ref|YP_003650294.1|
Domain Number 1 Region: 187-425
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.61e-70
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000229
Further Details:      
 
Domain Number 2 Region: 10-189
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 5.76e-61
Family Aminoacid dehydrogenases 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296242807|ref|YP_003650294.1|
Sequence length 426
Comment glutamate dehydrogenase [Thermosphaera aggregans DSM 11486]
Sequence
MNSLASLYENDPVYQMAVKQLKESISILGYPEEYVEILRHPEKLVQVKITIKRDNGKLET
FLGWRSQHNSALGPYKGGVRYGENVTPGEVVALSIWMTWKTSLAGLPYGGGKGGVRVNPK
ALSPRELEELSRKFFAGIARDVGPDVDIPAPDVYTNPQTMAWYFDEYSKIAGYNAWGVVT
AKPVDLGGLNARVVSTGYGTALTAREAAKKALGGFEGKTVAIHGFGNVGMYAAKYAQEWG
AIVVAVSDSSGYIYDPKGIDVEEAIRVKNETGKVTNYKKGNVKVSTNHLEVLELPVDVLI
PAATENVITMENVHRIKAKVISEGANGPTTPEADRILHDKGVVVVPDILANAGGVTMSWI
EWSHNRMGCWLTDDEALSRLDKMMTINFHRVYDDWQKRFSQYPMRIAAYAIAVDRVVKAM
KLRGWI
Download sequence
Identical sequences D5U2J2
gi|296242807|ref|YP_003650294.1| WP_013129935.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]