SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296454038|ref|YP_003661181.1| from Bifidobacterium longum subsp. longum JDM301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296454038|ref|YP_003661181.1|
Domain Number 1 Region: 105-291
Classification Level Classification E-value
Superfamily alpha/beta knot 1.9e-31
Family SpoU-like RNA 2'-O ribose methyltransferase 0.003
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily L30e-like 0.00000000000000139
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296454038|ref|YP_003661181.1|
Sequence length 292
Comment tRNA/rRNA methyltransferase SpoU [Bifidobacterium longum subsp. longum JDM301]
Sequence
MQFITLDTVDDPRVEAYVSLTEMQLRNRLEPAKGVFIAESPKVIDRALAADREPLSLLVE
EPWLEGMKDTFDFIDGRWGADIPVYVASPEQLKRLTGYRLHRGALCAMRRWLLPSVAEVC
RSARRVAVMENIVDHTNVGALMRSAAALDVDAVLATPSCGDPLYRRAARVSMGTVFQIPW
TRITGFNDDGTENKHYWPFQGIDELKSLGFTTVAMALEDRSISLDELTRRLHAPAEDPTH
IDKLAMIFGTEGDGLSHHTIARADLTVKIPMSHGVDSLNVAASSAVAFYATR
Download sequence
Identical sequences D6ZTZ5
gi|296454038|ref|YP_003661181.1| WP_013140645.1.10885 WP_013140645.1.48448 WP_013140645.1.86762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]