SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296454822|ref|YP_003661966.1| from Bifidobacterium longum subsp. longum JDM301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296454822|ref|YP_003661966.1|
Domain Number 1 Region: 25-241
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.13e-44
Family Phosphoglucomutase, first 3 domains 0.0018
Further Details:      
 
Domain Number 2 Region: 316-460
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.35e-33
Family Phosphoglucomutase, first 3 domains 0.0025
Further Details:      
 
Domain Number 3 Region: 448-557
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.31e-19
Family Phosphoglucomutase, C-terminal domain 0.0038
Further Details:      
 
Domain Number 4 Region: 215-327
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000053
Family Phosphoglucomutase, first 3 domains 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296454822|ref|YP_003661966.1|
Sequence length 558
Comment alpha-D-glucose phosphate-specific phosphoglucomutase [Bifidobacterium longum subsp. longum JDM301]
Sequence
MVANNAGQPATPADLINVDEVIGKYYDLVPDPEVPEQRVIFGTSGHRGSSLKTSFNEAHI
IAISQAIAEYRKKAGVTGPLYLGSDTHALSGPAKKTAIEVLVANGVHVRVDSRDDFVPTP
VVSQAILTHNRAADGTQRFEGEGLADGIVVTPSHNPPTDGGFKYDPVTGGPAPAETTNAI
AARANELLGDFKSIKRVPYEEAIKSEYVEGFDFREHYVDDLENVIDFDVIRNSGVRLGID
PLGGASVNYWPLINEKYGLNIGVVRPEVDPTWRFMTIDHDGKIRMDPSSPYAMKGLVDEL
NAGAWDKYDLVGGTDPDADRHGIVCPNWGVMNPNHYIAVCVEYLFGGNRPGWPEGAAVGK
TLVSSSLIDRVAASINAKVIEVPVGFKWFVDPLFSGEVAFGGEESSGMSFLRKDGRVWTT
DKDGLIPDLLAAEITAKTGKNPAQLHQEQVERFGESWYKRVDTPTTLEQKAKFAALSGDD
VTASTLAGEDITAKLTEAPGNHAKIGGLKVTTKDNWFAARPSGTENIYKVYAESFVSPEA
LDKVLDEATVVVDKALSE
Download sequence
Identical sequences A0A075NC23 A0A0A6VMC0 D6ZW80 E5XX83 F8ASI4 I3B7E1 I3BEG9 T2I2N1 V6Y2P7
WP_007055334.1.10885 WP_007055334.1.11999 WP_007055334.1.19800 WP_007055334.1.23590 WP_007055334.1.31269 WP_007055334.1.37587 WP_007055334.1.46548 WP_007055334.1.48448 WP_007055334.1.49187 WP_007055334.1.49359 WP_007055334.1.50584 WP_007055334.1.50944 WP_007055334.1.51653 WP_007055334.1.59461 WP_007055334.1.59950 WP_007055334.1.61280 WP_007055334.1.70526 WP_007055334.1.76173 WP_007055334.1.8287 WP_007055334.1.83561 WP_007055334.1.86762 WP_007055334.1.98069 WP_007055334.1.98685 gi|384200809|ref|YP_005586556.1| gi|296454822|ref|YP_003661966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]