SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296454952|ref|YP_003662096.1| from Bifidobacterium longum subsp. longum JDM301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296454952|ref|YP_003662096.1|
Domain Number 1 Region: 362-528
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.49e-46
Family Eukaryotic ODC-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 34-188
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.55e-35
Family Alanine racemase-like, N-terminal domain 0.0000518
Further Details:      
 
Domain Number 3 Region: 275-383
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.62e-20
Family Alanine racemase-like, N-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296454952|ref|YP_003662096.1|
Sequence length 530
Comment diaminopimelate decarboxylase [Bifidobacterium longum subsp. longum JDM301]
Sequence
MPISPIWPAATTVNANGAIAFHGRTAESLLDKFGSPLYLIDTDEVSARAKHFVRAAAEAF
NTSTTHVSFAGKAFLSKEIVRLVTEAGMFVDTCTMGEMKIALAAGVPGRRLVLHGNNKSD
EEIALAIEQGFAKIVIDEPDEPERVAAIARKLGKRARVMLRVTVGVHAGGHEYISTAHED
QKFGVPLLAAGADAAVLDVLNALKDVTPAATNARISATHSPENGAEKTEKSERELHYDVK
YPYDLSHEEVSDTDKALAAAMEAIADGPSIAVLKTILANQDVLELVGAHSHIGSNIHDAD
AFIHAAKRMMLLRKTLWATDAYILPEIDLGGGYSVAYTDGEDSMDIDVELTRLADAVNST
NRALGMPAPAISFEPGRYIVAPAGVTLYRVGAIKHVHLSDAKDSAGNPITERVYVSVDGG
MSDNIRPALYGADYTARLANRTGSAETMLARVCGMHCESGDIVVHEVQLPADLKRGDILA
VPVTGAYGRTMASNYNQALIPAVVAVSESGAHVMLRRQTVDDLLNLDVSE
Download sequence
Identical sequences D6ZWL0
gi|296454952|ref|YP_003662096.1| WP_013141370.1.10885 WP_013141370.1.48448 WP_013141370.1.86762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]