SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296138186|ref|YP_003645429.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296138186|ref|YP_003645429.1|
Domain Number 1 Region: 3-479
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.97e-196
Family Heme-dependent catalases 0.0000000000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296138186|ref|YP_003645429.1|
Sequence length 485
Comment catalase [Tsukamurella paurometabola DSM 20162]
Sequence
MTDHRNYTTTDSGAPAGSDQHSLTVGAGGPIVLHDHYLIEQMAQFNRERIPERQPHAKGS
GAFGTFETTADVSDYTCAALFQPGVTTDMVARFSTVAGERGSADTWRDPRGFALKFYTDE
GVYDLVGNNTPVFFIKDPLKFQHFIRSQKRRADNNLRDHDMQWDFWTLSPESSHQVTWLM
GDRGIPKSWRHMNGYGSHTYLWVNDAGVKHWVKYHFISDQGIDYLTQDEADRLAGADGDY
HVRDLFEAIRDGEHPSWTLKVQIMPFEDAATYRYNPFDLTKVWPHSDYPLVEVGTMTLHT
NPTDNHAQIEQAAFEPNNLVPGIGLSPDRMLLGRVFAYADAHRARLGANYKQIPVNAPRN
EVRSYSKDGAMRIDPVRDPVYAPNSKGGPSADYPGQAEPQWAADGEIVRTAYVDHAEDDD
VSQPRTLIREVMDEAARERLVDNVAGHLLDGVSPPVLQRAFEYWTNIDPEIGGRIERAVA
EAGTD
Download sequence
Identical sequences D5US23
gi|296138186|ref|YP_003645429.1| WP_013125132.1.58240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]