SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296139798|ref|YP_003647041.1| from Tsukamurella paurometabola DSM 20162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296139798|ref|YP_003647041.1|
Domain Number 1 Region: 73-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000405
Family NfeD domain-like 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|296139798|ref|YP_003647041.1|
Domain Number - Region: 11-73
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0994
Family Glycerol-3-phosphate transporter 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296139798|ref|YP_003647041.1|
Sequence length 143
Comment hypothetical protein [Tsukamurella paurometabola DSM 20162]
Sequence
MAAALWLIGAVLLAVAETAAGEFTLLMLGGGALITAGATGLFTLPLWAQGVVFAVSSVLL
LVLARPPLRRYVEARRADAPSYLESLPGMKAVVSAEVTGGGGRVLVGGEEWSARTPYDGA
PIPAGVEVTIVEIDGAVAIVVDS
Download sequence
Identical sequences D5UPE6
gi|296139798|ref|YP_003647041.1| WP_013126724.1.58240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]