SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298345981|ref|YP_003718668.1| from Mobiluncus curtisii ATCC 43063

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298345981|ref|YP_003718668.1|
Domain Number 1 Region: 172-286,412-506,535-684
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0000000000262
Family Phase 1 flagellin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298345981|ref|YP_003718668.1|
Sequence length 687
Comment flagellar hook-associated protein FlgK [Mobiluncus curtisii ATCC 43063]
Sequence
MGSTFSSLNAGLTGLYAAQRLIEVSGQNINNMNTPGYTRQRVEQRALGIGSEPSVFAGSV
PQGGGVEITRIRRLDDFFLDAKLRLETGRAAGTKETSEAWKGIESAMDELGRMSVSDSMR
TFFKSWGDVNNNSDNRGARASTLGAAEALVTNIKTGYTHINDLWKNGREQLDALVADLNT
TMDSVQKLNDRIRKTTVSGGNASGAVNHLKDERDQLIMHISKLTGATVRQGYSVYTKENA
PHPSMIGQAYEDGTVEVMLGGNSLVGKDYVNHFEVEGARDMAGIDAAPRDKYKAAVDALK
AGGKDITATFEYHGQKIQKYQAHVQRYEVGDEILKPDGSKKKLDSGDSEVGTKYVAFYDM
EDVQKGTKKLKEAKVEKTEQGFTEFTFMKDEGPARLRWELGGHVVAIEDGTIGGLMQNLK
PAQFPGVSGTIGSGGAWAETGKLYNDLATNLADEINGIHANNVGQKLPDGSTGNNNTKTL
VTKETKFYKVDLTKPVNDRDRMQELTGETLKRIDYKTEEAYDTAVKQKVAKLEKDHQGSG
IVYENVKEDGGDFFKFAATDNKLPAAMRLSVAVKDPQMIAAGQYVNGVYDGSVSLALGNR
QDAPTSAMNEWSKSVVDIGVHAKGADDKHTLAEQTRQIAEQQQKSQSSVDMNEEVINLIQ
GQHAYAGAARIMSTVNSMLEALINIGR
Download sequence
Identical sequences D6ZKC5
gi|298345981|ref|YP_003718668.1| WP_013189001.1.70285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]