SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298346843|ref|YP_003719530.1| from Mobiluncus curtisii ATCC 43063

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298346843|ref|YP_003719530.1|
Domain Number - Region: 34-95
Classification Level Classification E-value
Superfamily FlgN-like 0.00471
Family FlgN-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298346843|ref|YP_003719530.1|
Sequence length 113
Comment hypothetical protein HMPREF0573_11717 [Mobiluncus curtisii ATCC 43063]
Sequence
MTPKNGSVMVSLHATDTPPPTNLNIGRFQAKLGELIADNRVMDEKRELLMQLLFGNEDKP
GLSNEVTQPDNSPEAAARFQKWAKAQQKAQTINETLENSEKSADILREMMNRD
Download sequence
Identical sequences D6ZHC8 E6M2S2
WP_004010662.1.34359 WP_004010662.1.70285 gi|298346843|ref|YP_003719530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]