SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|344206222|ref|YP_004791363.1| from Stenotrophomonas maltophilia JV3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|344206222|ref|YP_004791363.1|
Domain Number 1 Region: 8-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.04e-105
Family FMN-linked oxidoreductases 0.00000000419
Further Details:      
 
Domain Number 2 Region: 339-525
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.24e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000108
Further Details:      
 
Domain Number 3 Region: 473-631
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|344206222|ref|YP_004791363.1|
Sequence length 676
Comment 2,4-dienoyl-CoA reductase [Stenotrophomonas maltophilia JV3]
Sequence
MSPANESAYPHLFAPLDLGFTQLRNRVLMGSMHTGLEDRARDFPRLAAYFAERAEGGVGL
IVTGGFAPNVVGWLKPFGGKLSWPWEVRPHRQLTAAAHQHGAKICLQLLHAGRYAYHPLS
VAPSKLKAPINPFTPRALSASGVERHIADYARSAKLAREAGYDGVEVMGSEGYLINEFIA
PRTNKRTDRWGGDASQRMRFAIEIVRRIREACGPDFIIIYRLSLVDLVDDGSNWEEIVQQ
AQAIEAAGATIINSGIGWHEARIPTIATSVPRAAFAGVTAKLKPHVKVPLVATNRINMPD
VAERILADGGADMVSLARPLLADPQWPNKARAGRAEAINTCIACNQACLDHVFENKLASC
LVNPRAAHETELVYRPTATPKKVAVVGAGPAGLACATVAAQRGHQVTLFDANEEIGGQFN
VAKRIPGKEEFHETLRYFRHTLAETGVQLRLGTRADAATLAGFDEVVLATGITPRKVDFP
GADHAKVVSYLDVLLGRVEVGSNAAIIGAGGIGFDVGEFLSHAGESPSLDPQRWMAEWGV
DSTFEARGSLARPEVEASPRRLWLLQRSPGKPGARLGKTTGWIHRATLKAKGVRMLGGVE
YLGVDDEGLRIRVDGSEQLLPVDHVVICAGQEPNRMLQAELQAAGINAQLIGGADVAAEL
DAKRAIDQGSRVAAAL
Download sequence
Identical sequences G0JZ84
WP_014036114.1.79657 gi|344206222|ref|YP_004791363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]