SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300721446|ref|YP_003710721.1| from Xenorhabdus nematophila ATCC 19061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300721446|ref|YP_003710721.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.71e-40
Family Frataxin-like 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300721446|ref|YP_003710721.1|
Sequence length 106
Comment protein cyaY [Xenorhabdus nematophila ATCC 19061]
Sequence
MNDSEFHQLADQLMLHLEEQLDNYDGDADIDCETNGGVMTLSFENGSKIIINRQEPFHQI
WLATKNGGYHFDYRDNQWMCDRSGNDLISILAQAITEQSGESFQFS
Download sequence
Identical sequences A0A0A8NT40 A0A0R4FJC5 D3VHZ5 N1NN23
gi|300721446|ref|YP_003710721.1| WP_010845301.1.22819 WP_010845301.1.51459 WP_010845301.1.61374 WP_010845301.1.95391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]