SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300722564|ref|YP_003711854.1| from Xenorhabdus nematophila ATCC 19061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300722564|ref|YP_003711854.1|
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 6.15e-29
Family MOSC N-terminal domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 288-369
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.96e-21
Family 2Fe-2S ferredoxin-related 0.014
Further Details:      
 
Domain Number 3 Region: 3-50,147-264
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000000398
Family MOSC (MOCO sulphurase C-terminal) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300722564|ref|YP_003711854.1|
Sequence length 370
Comment 2Fe-2S protein [Xenorhabdus nematophila ATCC 19061]
Sequence
MLTLSRLYTYPVKSMRGLQLSHSLVNESGLTFDRNFMITTMDGTFITGRQYPQMLLFTPT
MLHNGLYLQAPNGESATALYADFKEERLPTEVWGTHFTALVAPESINAWLSRFFDTPVQL
RWLSEELTRRVKIFPDISLSFADGFPYLIINEASFHALQQRCPASIKIEQFRANIIITGA
APFKEDNWQVIQIGDIIFDLPKPCSRCILTTVSPEKGRKNPQGEPLATLSSFRTAEEDGA
VDFGQNAIARNSGIIHIGDRVTVLEKRTPRKYSRSGQTKNLNIQKTVEQPVSIEFNGQHF
IGNNQQIVLEQLENQGFKIPYSCRAGICGSCKITLIEGDVIPLKSSAIKENGKILACSCI
PKNDLIIELN
Download sequence
Identical sequences A0A0R4FLF9 D3VC03
gi|300722564|ref|YP_003711854.1| WP_013183937.1.61374 WP_013183937.1.95391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]