SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300724669|ref|YP_003713994.1| from Xenorhabdus nematophila ATCC 19061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300724669|ref|YP_003713994.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 3.73e-127
Family UbiD middle domain-like 0.0000000000306
Further Details:      
 
Domain Number 2 Region: 323-485
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 4.71e-66
Family UbiD C-terminal domain-like 0.0000000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300724669|ref|YP_003713994.1|
Sequence length 490
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Xenorhabdus nematophila ATCC 19061]
Sequence
MKYRDLRDFLSLLEQSGELKRIRVEVDPYLEMTEIADRTLRAGGPALLFENPKGYSMPVL
CNLFGTPKRVAMGMGQDDVKALHDVGQLLAFLKEPEPPKGFRDLVGKLPKFKQVLNMPTK
RLNSAPCQEQIWAGDEVDLSRIPVMHCWPEDAAPLITWGLTVTKGPNKERQNLGIYRQQV
LGKNKLIMRWLSHRGGALDFQEWCQAYPGERFPVSVALGADPATILGAVTPVPDTLSEYA
FAGLLRGHKTEVVRCLSNELEVPASAEIILEGYIEPGEMAPEGPYGDHTGYYNEVDMFPV
FTVTHITQRRDAIYHSTYTGRPPDEPAVLGVALNEVLVPILQKQFPEIVDFYLPPEGCSY
RLAVVTIKKQYAGHAKRVMMGVWSYLRQFMYTKFVIVCDDDINARDWNDVIWAITTRMDP
QRDTVLMENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIVMSDEIRSRVDE
IWDQLDILKR
Download sequence
Identical sequences A0A0R4CZI7 D3VBR7
WP_013185342.1.61374 WP_013185342.1.95391 gi|300724669|ref|YP_003713994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]