SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300724961|ref|YP_003714286.1| from Xenorhabdus nematophila ATCC 19061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300724961|ref|YP_003714286.1|
Domain Number 1 Region: 20-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300724961|ref|YP_003714286.1|
Sequence length 107
Comment hypothetical protein XNC1_4185 [Xenorhabdus nematophila ATCC 19061]
Sequence
MQKGIFDNSIADETVSWETAGNTLFLKGTLDRDSLLPLWQQKESALEGIDNIDVSRLSHV
DSTGLALFVRLKGEYQQGGRILSFSGVGECLNTLIALYGLQRLLEGN
Download sequence
Identical sequences A0A0A8NZ53 A0A0R4CZQ8 D3VDH0 N1NKX1
WP_010847751.1.22819 WP_010847751.1.51459 WP_010847751.1.61374 WP_010847751.1.95391 gi|300724961|ref|YP_003714286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]