SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296135971|ref|YP_003643213.1| from Thiomonas intermedia K12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296135971|ref|YP_003643213.1|
Domain Number 1 Region: 200-332
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 0.0000000000000275
Family Cell-division protein ZipA, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296135971|ref|YP_003643213.1|
Sequence length 351
Comment ZipA FtsZ-binding region [Thiomonas intermedia K12]
Sequence
MGQLQIALIVIGAIIIAAVIAYNTWQSGKFKRQRAAVEDDVQTAIEPAGLDTLASDTHGH
TLEPVALSPEVAPRPRLMPLQIDPLIDAIASYLLEPVRSGEVLLPRLPKTARAGAKRMLF
EGRNAETGQWEPLQPQHPYAELQAAVQLSNRAGPINAIEFSEFIAKCHELGEALSVAPDL
PDMAEALEQARSLDAFANDNDAQLSITLRARSVPWGIDFLRQRAQAAGFVPGAEAGRMVL
LYQDVEQAPTPLVHLQFDARADLSDSAAAVSHATLLLEVPQAPAAQKPFGRMRQAARELA
TALDAAVVDDNNAPLPDAALDHIEKQLDLLYEVLEQRGLPAGSAAAQRLFS
Download sequence
Identical sequences A0A259RJ61 D5X187
WP_013123144.1.68284 gi|296135971|ref|YP_003643213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]