SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296136632|ref|YP_003643874.1| from Thiomonas intermedia K12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296136632|ref|YP_003643874.1|
Domain Number 1 Region: 21-293
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.08e-94
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000234
Further Details:      
 
Domain Number 2 Region: 358-457
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.54e-17
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0013
Further Details:      
 
Domain Number 3 Region: 294-337
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000000161
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296136632|ref|YP_003643874.1|
Sequence length 467
Comment cytochrome b/b6 protein [Thiomonas intermedia K12]
Sequence
MADQSLHGAHAAPEHGGLRGWVDKRFPFSSLWSAHLTEYYAPKNLNFWYYFGSLSIVVLA
IQIISGIFLVMNYKPDAALAFGSVEYIMRDVNWGWLIRYIHSTGASAFFIVVYLHMFRGL
IYGSYRTPRELIWIFGCLIFLSLMAEAFFGYLLPWGQMSFWGAQVIVNLFSAIPYIGPDL
AVWIRGDYVVSDVTLNRFFAFHVIAIPLLLIGLVGSHIIALHQVGSNNPDGVEIKDNKDG
RGIPRDGVAFHPYYTVHDLFGLSVFLMIFCAVVFFAPQFGGYFLEHNNFIPANPLKTPPH
IAPVWYFTPFYSILRATTSNTVHIWMGVVVVATLFALWRNRGKPGRAVSFAVGGGLLFWA
LASVDAKFWGVVSMGGAVIIFFFLPWLDKSPVKSIRYRPTWHRAVYTLFAINFVVLGYFG
IQPPSPVAYAVALTCTLLYFGFFFLMPWWSRLGEFKPVPQRLTYKAH
Download sequence
Identical sequences A0A160SS31 A0A1D2USA4 A0A259RI74 D5X3V7 D6CV35
gi|296136632|ref|YP_003643874.1| WP_013106445.1.17751 WP_013106445.1.2408 WP_013106445.1.37844 WP_013106445.1.68284 WP_013106445.1.92352 gi|410694337|ref|YP_003624959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]