SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296134965|ref|YP_003642207.1| from Thiomonas intermedia K12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296134965|ref|YP_003642207.1|
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily SIS domain 7.48e-55
Family mono-SIS domain 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296134965|ref|YP_003642207.1|
Sequence length 199
Comment sugar isomerase (SIS) [Thiomonas intermedia K12]
Sequence
MLEQRIQQHFFDSADLKYQAAEALTGPIARAVDVLATAVSNGHKILICGNGGSAADSQHL
AAELVGRFERERPELAAIALTTDTSTLTAVANDYGFDHVFAKQVRALGLPGDVLVAFSTS
GNSSSIVEAVRAAQAREMSVLALTGRTGGRVAGLLREADVHIAVPNDRTARIQEVHLLTL
HCLCDGLDWVLMGEPESLA
Download sequence
Identical sequences A0A078BCX5 A0A160SR82 A0A257P4W1 A0A259REG5 A0A259RW72 D5X553 D6CRQ2
gi|410692525|ref|YP_003623146.1| WP_013104663.1.17751 WP_013104663.1.2408 WP_013104663.1.37844 WP_013104663.1.68284 WP_013104663.1.92352 gi|296134965|ref|YP_003642207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]