SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297571492|ref|YP_003697266.1| from Arcanobacterium haemolyticum DSM 20595

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297571492|ref|YP_003697266.1|
Domain Number 1 Region: 77-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000275
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297571492|ref|YP_003697266.1|
Sequence length 139
Comment hypothetical protein Arch_0925 [Arcanobacterium haemolyticum DSM 20595]
Sequence
MAWGIWAIISAVLLILEMLTVDFTFTMVAGGALAAAGVSALGGNLVMQVATFAVVSTVLL
LVVRPWARKHINNSSTGESNVYALVGRGGIALSAIDENSGQAKIGGDVWSASTLEGPIEP
DTAVIVSAVEGARVVVVTA
Download sequence
Identical sequences D7BNZ8
WP_013170143.1.46033 gi|297571492|ref|YP_003697266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]