SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297571538|ref|YP_003697312.1| from Arcanobacterium haemolyticum DSM 20595

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297571538|ref|YP_003697312.1|
Domain Number 1 Region: 27-251
Classification Level Classification E-value
Superfamily Undecaprenyl diphosphate synthase 4.84e-81
Family Undecaprenyl diphosphate synthase 0.00000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297571538|ref|YP_003697312.1|
Sequence length 266
Comment undecaprenyl diphosphate synthase [Arcanobacterium haemolyticum DSM 20595]
Sequence
MERITPTMHDPIAPPAGIAGPPAIPADAVPKHVAVVMDGNGRWANERHLPRTEGHRAGEK
ALMDVLAGAVEIGVEVVSVYAFSTENWKRSPSEIAFLMNYSRDVIHRRRHELDDWGVKIV
WSGRQPRLWSSVIKELQEAQRLTMYNSTMTLNFCCNYGGRAEIADAVAEIAAAAARGEIK
PRKINEETIAQALYQPHLPDVDLFIRSGGEQRTSNFMLWQASYAEMMFVDEPWPEFDRNV
LWRCIEQYASRNRRFGGAVDQVTQES
Download sequence
Identical sequences D7BP44
WP_013170189.1.46033 gi|297571538|ref|YP_003697312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]