SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297616434|ref|YP_003701593.1| from Syntrophothermus lipocalidus DSM 12680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297616434|ref|YP_003701593.1|
Domain Number 1 Region: 5-49
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000405
Family BAS1536-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297616434|ref|YP_003701593.1|
Sequence length 53
Comment hypothetical protein Slip_0241 [Syntrophothermus lipocalidus DSM 12680]
Sequence
MDVKERIELARTLLNNAARMNARKELIYRLSQKVDQYVVEYMRKELKSEDKSN
Download sequence
Identical sequences D7CJD9
gi|297616434|ref|YP_003701593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]