SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297616979|ref|YP_003702138.1| from Syntrophothermus lipocalidus DSM 12680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297616979|ref|YP_003702138.1|
Domain Number 1 Region: 110-309
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 4.58e-53
Family MurCDEF 0.00023
Further Details:      
 
Domain Number 2 Region: 311-451
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.43e-44
Family MurCDEF C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 2-97
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 0.000000000000183
Family MurCD N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297616979|ref|YP_003702138.1|
Sequence length 456
Comment UDP-N-acetylmuramoylalanine/D-glutamate ligase [Syntrophothermus lipocalidus DSM 12680]
Sequence
MKIRGKKFIVIGLAKSGVAVARTLARRGGRVTVYDQKAEEQLGKALAELAEFDVKKVLGE
ELTIKPGEYDLAVVSPGVSMDAEVVRRVIEAGTPVIGEIELAYHLKNDAVEIVAITGTNG
KTTTTAFVAEILDKSGVNTAACGNIGVPLISVIDEIEHGVVSVEVSSFQLETIREFHPRV
AAVLNITPDHLDRHGTMEQYVEAKAKILSNQGPDDFSVLNYEDAWVRRLKTEAKSQVIFF
STARRLPRGVYVEDGKIKARLYDDEVVICPRENVALRGEHNLENVLCAVGIAIALGVKPD
TIADTLRSFKGVRHRLEEVRRVNGVLYVNDSKGTNPESTIKALQAFQEPVILIAGGRNKG
ADFTVLSRVIKDKVRHLVLVGEASLLIREKVLEQGFQHIDVAKSFEEAVYRAKELARPGD
VVLLSPACASWDMFNSFEERGDLFCQLVNSLEEERV
Download sequence
Identical sequences D7CLI8
gi|297616979|ref|YP_003702138.1| WP_013174975.1.24510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]