SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297617522|ref|YP_003702681.1| from Syntrophothermus lipocalidus DSM 12680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297617522|ref|YP_003702681.1|
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily AF1862-like 0.00000000157
Family Cas Cmr5-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297617522|ref|YP_003702681.1|
Sequence length 140
Comment CRISPR-associated Cmr5 family protein [Syntrophothermus lipocalidus DSM 12680]
Sequence
MHNVHLVQSYIPAAEKAVREILVENGKVKKIYKSYMAAFGPTIVQMGLLPCIAFYLGNSQ
GEGDRRVIVHLIAKVVGSKDGHELYKQLASSYENDMSSFYRTKQQVEAAAVALKLAMRTY
PDEESNESREEENNGRVQAS
Download sequence
Identical sequences D7CN31
gi|297617522|ref|YP_003702681.1| WP_013175518.1.24510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]