SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297617897|ref|YP_003703056.1| from Syntrophothermus lipocalidus DSM 12680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297617897|ref|YP_003703056.1|
Domain Number 1 Region: 167-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.92e-59
Family Methylesterase CheB, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily CheY-like 1.42e-28
Family CheY-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297617897|ref|YP_003703056.1|
Sequence length 357
Comment response regulator receiver modulated CheB methylesterase [Syntrophothermus lipocalidus DSM 12680]
Sequence
METSNVVRVLIVDDSALMRKTLRQILERDPEVEVVAAARDGEDAVAKAREYRPDVVTMDV
NMPKQDGITALQYIVNEDICPVIMVSSLTQEGAVTTFEALELGAFDFVAKPGGTVSSNLE
TVADELVTKIKAAAGLKKRKITARLSRARRSRGRQVVKKTGDTASGDMKAVAMGISTGGP
KMIYEVLPSLPANLNAAVFLVQHMPPNFTSAYVKRLNEHCQLEVVEAEAGMKVRPGVVYV
GRGGRHLSLVKNSLGEAVIRLPSQPPHHFMPSVGVMMEAVLKVFGPRTIGVLMTGMGDDG
ADAMVKIRQGGGLTIAESEESAIVFGMPGEAIKRGGAEIVVPIWDIAAEIVKAVGVV
Download sequence
Identical sequences D7CP56
gi|297617897|ref|YP_003703056.1| WP_013175893.1.24510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]