SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Amamu1|160359|fgenesh1_kg.13_#_170_#_Locus22153v1rpkm1.42 from Amanita muscaria Koide v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Amamu1|160359|fgenesh1_kg.13_#_170_#_Locus22153v1rpkm1.42
Domain Number - Region: 51-92
Classification Level Classification E-value
Superfamily DOPA-like 0.0183
Family DOPA dioxygenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Amamu1|160359|fgenesh1_kg.13_#_170_#_Locus22153v1rpkm1.42
Sequence length 302
Sequence
MSSPTASLCAIGASVWQYYGPLFLGGVSATFFSGMMAIQTIVYVKLYHKDIKYMKALVGP
HPVCAIDVAQTGLTWNALWYYLVRNFGDFTKLDDLPINRNFWIAAPIAILMTIRFRASVE
MIHLKKFTILMTRYKWLITLGLCCSIIVDVTITATLAFLLLIKSRGRLEVGNQVMVLTSL
NDIADSLILYTLELGSVTGLTSILSLIFWLQLDNHMVFTGLYISFGKLYGNCLMAMLNMR
YSLRQKRPMTREWGTKDWRPHPQVTPGSSLSLPVHVHVDVSRSTQSDNGNHYARKLAPES
NL
Download sequence
Identical sequences A0A0C2XBU5
jgi|Amamu1|160359|fgenesh1_kg.13_#_170_#_Locus22153v1rpkm1.42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]