SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302870844|ref|YP_003839480.1| from Caldicellulosiruptor obsidiansis OB47

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302870844|ref|YP_003839480.1|
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily AF1862-like 2.88e-22
Family Cas Cmr5-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302870844|ref|YP_003839480.1|
Sequence length 123
Comment Cmr5 family CRISPR-associated protein [Caldicellulosiruptor obsidiansis OB47]
Sequence
MNIKSIEQEMAQFCFNEISSYKIKLDKSDELLKFKSDIRRLPAMITNNGLLATLVFFKKS
NENVYNIINGWFSNKLQNIDLIEYLTKENYEDLLFKTSEVLKLANWLKRIVEVEIKDVKT
TEE
Download sequence
Identical sequences D9THC9
WP_013289501.1.77117 gi|302870844|ref|YP_003839480.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]