SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302871513|ref|YP_003840149.1| from Caldicellulosiruptor obsidiansis OB47

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302871513|ref|YP_003840149.1|
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.47e-35
Family Ribosomal protein L6 0.0000225
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.23e-29
Family Ribosomal protein L6 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302871513|ref|YP_003840149.1|
Sequence length 182
Comment 50S ribosomal protein L6 [Caldicellulosiruptor obsidiansis OB47]
Sequence
MSRIGRKPIDIPSGVDVKIDGNVITVKGPKGTLTKEIHPEMIVKIENNQIIVQRPSDERF
HKALHGLTRTLIANMVEGVTKGYEKVLEVVGIGYRAQKQGKKLILNVGYSHPVEIEEPAG
ITVEVPDQNRIIVKGIDKQQVGNFAANIRKVREPDPYLGKGIKYADEVLRLKEGKAGKGG
KK
Download sequence
Identical sequences D9TJI1
gi|302871513|ref|YP_003840149.1| WP_013290164.1.77117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]