SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300709401|ref|YP_003735215.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300709401|ref|YP_003735215.1|
Domain Number 1 Region: 62-319
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 8.18e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 330-526
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.83e-37
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300709401|ref|YP_003735215.1|
Sequence length 649
Comment 5'-Nucleotidase domain-containing protein [Halalkalicoccus jeotgali B3]
Sequence
MADDCGWDHDETRKRGEPARERSSIRKRGRTPRRTVLAASVAGLAGTALSGRAGAQTEND
TVTIVHDLHTHSGIGPLDGPNIARYRTVIDEQLAAREDAVFLTSGDELGSSPVSFFTKGT
HNVAFMNELDIAAAGVGNHDFDYGVETAAERFESSEFPWINSALSTPEGDPIPGTERWRT
IEVGDLTLGVFNVVVRGFHNITDYPEEYVAGDPVEVSREMVETLEAEGADVIVLASHVAH
DTHYEITEAVDGLDAIFGSHSHITFDEAEVHEGTVISEIGYAYAHLGVMTLDSSGELLEW
ERIDLDESVEPDPAFDARMRVQYADLEEELSREVGETAVELDADGTVTNGRESRLGNLIT
DAIRETVDAEIALQTAGRIRTDNTYGPGTLTTRDVLQIMPFTDTLMAFEATGEEIREALE
GRIDYLPEDPFGARQRQQVGGLNYEWSGHDEPEVGAVYVAGEELDPEGSYTVGTTGYVKN
TALGYESLRDNEVLRETDAGLGPAVMEYVESRGRVAPGIENRILRTDAEVGTATERSLVD
EEFRVRFEIPDRVESIHEGSFYALTTAGERYDARQATREGESVEVAFDRAGWGAFAPAGD
EHPIRVFGGFEPDDAAYGYRDEDDDPRELPVTDAVEGFVMKGLLDAEST
Download sequence
Identical sequences D8J3T2
WP_008419173.1.63939 WP_008419173.1.7794 WP_008419173.1.86325 gi|300709401|ref|YP_003735215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]