SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300709542|ref|YP_003735356.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300709542|ref|YP_003735356.1|
Domain Number 1 Region: 25-332
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.38e-103
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000177
Further Details:      
 
Domain Number 2 Region: 416-593
Classification Level Classification E-value
Superfamily RuvA domain 2-like 7.41e-52
Family NAD+-dependent DNA ligase, domain 3 0.0000656
Further Details:      
 
Domain Number 3 Region: 336-410
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-23
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00059
Further Details:      
 
Domain Number 4 Region: 602-681
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000011
Family DNA ligase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300709542|ref|YP_003735356.1|
Sequence length 703
Comment NAD-dependent DNA ligase LigA [Halalkalicoccus jeotgali B3]
Sequence
MNESDQNPYLRDPPEDLTPIDELDEAEREARRLREAIRHHDRRYYVENDPEIADRTYDTL
FQRLVDIEESFGLQIPDSPTRRVGGEPVEELETVEHVAPMLSIQQSGDAADVREFAERMD
REIGEVTYTCEPKFDGVSIEVVYDEGVFERAVTRGNGREGDDVSANVRTIRSIPQRLRGE
YPDFLAVRGEIFMPRDAFQAYNRERVERGDEPFANPRNATAGTIRQLDPTVTAERPLDCF
FYDILDASEGIATHWEELDALESYGLQTNDRAELAADIDEAIAYRDRLVEDREGLNYEID
GVVIKVDEKAACEELGTTSRHYRWAFAYKFPARAGETAIQDVALQVGRTGRLTPVALLDP
VDVGGVTVSRASLHNPAEIEEKEVNVGDVVRVERAGDVIPYVDEVVEKRSSGYFEFPATC
PVCDSAIERDGPIAFCTGGLACPAQLRRSVEYYASDSGLDIEGLGGERVDQLLEAGLVEE
SVADLYRLERADLVELEGWGQKSAENLLAELEASKSPPLFAFLAAIGIPHVGRATARELA
GAFGDLDGLMDASEDELREVDEIGEVVAREIRDFFDSEGNRRVLRELREAGVEPERAEDR
ESGDTLSGLTVVFTGSLPDRTRSEAQGLIEGAGGSVTGSVSGNTDYLVVGENPGSSKRED
AADEGVPELTPEEFEALVDESEEADRQEQQESSNQRTLEDTFQ
Download sequence
Identical sequences D8J4K2
WP_008418921.1.63939 WP_008418921.1.7794 WP_008418921.1.86325 gi|300709542|ref|YP_003735356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]