SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300710610|ref|YP_003736424.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300710610|ref|YP_003736424.1|
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-30
Family GHMP Kinase, N-terminal domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 154-271
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.56e-26
Family Homoserine kinase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300710610|ref|YP_003736424.1|
Sequence length 291
Comment homoserine kinase [Halalkalicoccus jeotgali B3]
Sequence
MVTVRAPATSANLGSGFDVFGAALSKPADVVRVEPAEATTIEMAGAGSEFIPEDPEKNVA
GAVAKALESPATIRIDKGVRPSSGLGSSAASAAAVAVGINAAYDLGYSREELVPYAAEGE
ALVSGEAHADNVAPSIMGGFTIATPEGVTQVDASIPLVVCLPEIVISTRDARRVVPRSAQ
VSQIVECVGRAATLVAGMFRDDPDLVGQGMEDGIVTPARADLIDGYADVREAALEAGATG
VTVSGAGPAIIAACEERRRKPIASAMLDRFAGEGIEARAYQTRVGRGAELF
Download sequence
Identical sequences D8JAB0
WP_008414835.1.63939 WP_008414835.1.7794 WP_008414835.1.86325 gi|300710610|ref|YP_003736424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]