SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300710705|ref|YP_003736519.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300710705|ref|YP_003736519.1|
Domain Number 1 Region: 115-187,317-415
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00000185
Family Acetylhydrolase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300710705|ref|YP_003736519.1|
Sequence length 417
Comment hypothetical protein HacjB3_06700 [Halalkalicoccus jeotgali B3]
Sequence
MVTVVPIALGVVALAIAAEVVSQRALERYGEGLGSMPTVVLEEFPEISSGLLGKYTSFDP
DLGWVPQPDQQKQKDTGDHLPGEEVESVVTYSTDEYGSRVCPAADRDEGRGAVSTYGDSY
CFCREVDDEDTFQNRLARRIDAHVGNYGGGNYGLDQALLRMKRQYPEDPTDHVCIVVTAS
SIARILSVWKHYQEFGNVLAVKPRYELRDGELELLESPVDEKEDLLDLESRAPFLRTHDG
HYENWFKPHLASFPYATDFLDDPDQVKYALYAAGMDLESEYGISIPGVDLGARQAATTLR
LEQSRVRYHERLFEEKADLFDALIGEFVSYADEHDFTPTFVMVQQLRYAAHEADRGPIYG
DLMDRLDERYPDLETIDMAEHLSGDPESLYVQRGEGGHYSPETNARIAEVLEERLIE
Download sequence
Identical sequences D8JAK5
WP_008414994.1.63939 WP_008414994.1.7794 WP_008414994.1.86325 gi|300710705|ref|YP_003736519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]